Human Novel Coronavirus Spike glycoprotein(S) protein

SKU: orb668863

Description

Recombinant Human Novel Coronavirus Spike glycoprotein(S) (G476S) protein

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Non-Animal,Infectious Diseases,Microbiology

Images & Validation

• Application Notes:
  SARS-CoV-2 Related Proteins

Key Properties

• Source: Mammalian cell
• Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (G476S) at 5 μg/ml can bind human ACE2, the EC50 is 47.11-92.3 ng/ml.
• Tag: C-terminal 10xHis-tagged
• Expression Region: 319-541aa (G476S)
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• MW: 27.9 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQASSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

/

Quick Database Links

UniProt

P0DTC2