You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Neuroscience
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 28-116aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 25.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−NRN1
Similar Products
−Human NRN1 protein (Active) [orb359184]
> 97% as determined by SDS-PAGE and HPLC.
9.7 kDa
E.Coli
5 μg, 100 μg, 500 μgHuman NRN1 protein [orb392207]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
50 μg, 500 μg, 10 μg
Human NRN1 ELISA Kit [orb404916]
Human
31.25 pg/mL-2000 pg/mL
7.81 pg/mL
10 x 96 T, 5 x 96 T, 48 T, 96 T, 24 TRecombinant Human Neuritin protein(NRN1) (Active) [orb1650593]
5 μg, 100 μg, 500 μg, 1 mg, 250 μg, 20 μgRecombinant Human Neuritin/NRN1 Protein, His Tag [orb1551971]
≥90% as determined by SDS-PAGE
This protein contains the human NRN1(Ala28-Gly116) was fused with the N-terminal His Tag and expressed in E. coli.
100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks