Human NT-proBNP Protein

SKU: orb1474960

Description

N-terminal pro-brain (or B-type) natriuretic peptide (NT-proBNP) is produced predominately by the cardiac ventricular myocytes. NT-proBNP is released in response to volume expansion and filling pressure and is involved in maintaining intravascular volume homeostasis. Elevated plasma levels of BNP and NT-proBNP have been observed at times of cardiac stress and damage

Images & Validation

• Tested Applications: ELISA, WB

Key Properties

• Source: E.coli
• Reactivity: Human
• Tag: N-terminal 6xHis
• Endotoxins: < 0.2 EU/ug
• MW: 12.6 KDa
• Purity: > 95%
• Protein Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHPLGSPGSASDLETSGLQEQRNH LQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

Storage & Handling

• Storage: Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. Avoid repeated freezing/thawing cycles
• Form/Appearance: Lyophilized at 1 mg/mL in PBS
• Buffer/Preservatives: Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

natriuretic peptide Precursor