You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Neuroscience
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 82-210aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 17.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Neurotrophin-5 , NT-5Neutrophic factor 4
Similar Products
−Human NTF4 protein (Active) [orb359176]
> 97% as determined by SDS-PAGE and HPLC.
14.1 kDa
E.Coli
10 μg, 500 μg, 100 μgHuman Neurotrophin-4 protein [orb80091]
FA, HPLC, SDS-PAGE
Unconjugated
> 97.0% as determined by RP-HPLC and analysis by SDS-PAGE
10 μg, 100 μg, 500 μgRecombinant Human Neurotrophin-4 protein(NTF4) (Active) [orb1650592]
100 μg, 500 μg, 1 mg, 10 μg, 250 μgHuman NT 4 Protein [orb427415]
Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
10 μg, 1 mg, 2 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
