You have no items in your shopping cart.
Human Papilloma Virus type 16 (HPV 16) Protein E6 (His)
SKU: orb1978083
Description
Research Area
,Recombinant-Protein
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Expression System | P. pastoris (Yeast) |
|---|---|
| Biological Origin | HPV 16 |
| Biological Activity | Human Papilloma Virus type 16 (HPV 16) Protein E6 (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.2 kDa and the accession number is P03126. |
| Tag | N-6xHis |
| Expression Region | 1-158 aa |
| MW | 21.2 kDa (predicted) |
| Purity | 98.00% |
| Protein Sequence | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 1
Recombinant HPV16 E6 protein, DsbC & His [orb1516270]
> 95% as determined by SDS-PAGE
50 kDa
100 μg, 500 μg Human Papilloma Virus type 16 (HPV 16) Protein E6 (E. coli, His) [orb1978084]
90.00%
23.2 kDa (predicted)
1 mg, 100 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days