You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Cancer,Epigenetics,Developmental Biology,Cancer
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 82-190aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 14.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PDGF-2 (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide) (Proto-oncogene c-Sis) (Becaplermin) (PDGF subunit B) (PDGF2) (SIS)
Similar Products
−- Item 1 of 2
Recombinant human PDGF R Beta protein, C-His-Avi (HEK293) [orb1516344]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result. kDa
50 μg - Item 1 of 2
Recombinant human PDGF R Beta protein, C-His-Avi (HEK293), Biotin conjugated [orb2328734]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result. kDa
20 μg Human PDGFRB Protein [orb1477114]
Greater than 85% as determined by SDS-PAGE.
54.6 kDa
E.coli
1 mg, 20 μg, 100 μgHuman PDGF B protein [orb604301]
Greater than 85% as determined by SDS-PAGE.
28.3 kDa
E.coli
100 μg, 1 mg, 20 μgHuman PDGF B protein [orb594736]
Greater than 98% as determined by SDS-PAGE.
12.42 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Human PDGF B protein (orb604302)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks