You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Cell Biology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 1-140aa |
| Protein Length | Full Length |
| Endotoxins | Not test. |
| MW | 32.1 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PDZD11
Similar Products
−
Human PDZD11 Protein [orb427602]
Greater than 90.0% as determined by SDS-PAGE.
Escherichia Coli
2 μg, 10 μg, 1 mgHuman PDZD11 Protein, His Tag [orb2700449]
> 97%, determined by SDS-PAGE
This protein contains the human PDZD11 (NP_0575681) (Asp 2-His 140) was expressed with a polyhistide tag at the N-terminus and expressed from E. coli.
100 μg, 20 μgPDZD11 Protein, Human, Recombinant (His) [orb1957774]
98.00%
16.9 kDa (predicted); 18 kDa (reducing conditions)
100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks