You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Signal Transduction
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | in vitro E.coli expression system |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 25-622aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 71.9 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−AI987712, CLONE SPM213, CPRLP, Delta 4-delta 7/11 truncated prolactin receptor , Delta 4-SF1b truncated prolactin receptor , HPRL, hPRL receptor, hPRLrI, Lactogen receptor, MFAB, MGC105486, OPR, OTTHUMP00000115998 , Pr-1, Pr-3, PRL R, PRL-R, PRLR, Prlr-rs1, PRLR_HUMAN, Prolactin receptor a, Prolactin receptor, Prolactin receptor delta 7/11 , RATPRLR, Secreted prolactin binding protein , Truncated testis-specific box 1-C prolactin receptor , wu, fj65c07
Similar Products
−- Item 1 of 3
Human PRLR Protein, hFc Tag [orb1290927]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 50.5 kDa after removal of the signal peptide. The apparent molecular mass of PRLR-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 2
PRLR purified MaxPab rabbit polyclonal antibody (D01P) [orb2292335]
WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 1
Human PRLR Protein, His Tag [orb1826877]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 25.8 kDa after removal of the signal peptide. The apparent molecular mass of PRLR-His is approximately 25-35 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
- Item 1 of 1
Recombinant human PRL-R protein, C-His (HEK293) [orb1817205]
> 90% as determined by SDS-PAGE
36 kDa
500 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks