You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Developmental Biology,Cancer
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Loaded Recombinant Human OPG-Fc on Pro A Biosensor, can bind Human RANKL with an affinity constant of 1.83 pM as determined in BLI assay. ②Loaded Human RANK-His on HIS1K Biosensor, can bind Human RANK L with an affinity constant of < 1 pM as determined in BLI assay. |
| Tag | Tag-Free |
| Expression Region | 140-317aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 22.4 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD254; ODF; OPGL; RANK L; TNFSF11; CD254; Osteoclast differentiation factor; Receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor ligand superfamily member 11
Similar Products
−- Item 1 of 4
Human TNFSF11 Protein, hFc Tag [orb757436]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 48.4 kDa after removal of the signal peptide.The apparent molecular mass of hFc-TNFSF11 is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg 
Human RANKL protein [orb392615]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μgRecombinant Human Osteoprotegerin/Fc Chimera (rHuOPG-Fc) [orb1495077]
> 90% by SDS-PAGE and HPLC analyses.
Recombinant OPG/Fc contains 412 amino acid residues, including 180 residues from mature OPG (a.a 22-201) and 232 residues from the Fc protein of human IgG1, and has a calculated molecular mass of 46.5 kDa. As a result of glycosylation, the recombinant OPG/Fc migrates as a 49 kDa protein in SDS-PAGE under reducing conditions.
Pichia. Pastoris.
1 mg, 50 μg, 10 μgRecombinant Human RANK L/TRANCE/TNFSF11 Protein, His Tag [orb1551754]
≥90% as determined by SDS-PAGE
This protein contains the human TNFSF11(Ile140-Asp317) was fused with the N-terminal His Tag and expressed in E. coli.
50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks