You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Cancer
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using MO7E human megakaryocytic leukemic cells is 0.55 ng/ml. |
| Tag | N-terminal 6xHis-tagged and C-terminal 6xHis-tagged |
| Expression Region | 22-353aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 37.3 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Thrombopoietin;C-mpl ligand;Megakaryocyte colony-stimulating factor;Megakaryocyte growth and development factor;Myeloproliferative leukemia virus oncogene ligand;THPO
Similar Products
−- Item 1 of 1
Human TPO (N, C-6His) Protein [orb1471766]
Greater than 95% as determined by reducing SDS-PAGE.
37.3 KDa
Mammalian
10 μg, 50 μg 
Human THPO protein [orb604411]
Greater than 85% as determined by SDS-PAGE.
34.7 kDa
E.coli
20 μg, 100 μg, 1 mg- Item 1 of 1
Recombinant human TPO protein (Active, HEK293) [orb1817180]
> 95% as determined by SDS-PAGE
80-85 kDa
100 μg, 50 μg, 10 μg Human THPO protein [orb392562]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks