You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Cancer
Images & Validation
−
Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 μg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml. |
| Tag | N-terminal hFC-Myc-tagged |
| Expression Region | 74-240aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| MW | 46.7 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(Herpes virus entry mediator ligand)(HVEM-L)(Herpesvirus entry mediator ligand)(CD258)(HVEML)(LIGHT)(UNQ391)(PRO726)
Similar Products
−- Item 1 of 3
Recombinant human LIGHT (Trimer) protein, N-His-Flag (HEK293) [orb1516393]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 52-140 kDa based on Tris-Bis PAGE result. kDa
50 μg - Item 1 of 2
Human LIGHT Protein, hFc Tag [orb757459]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 2
Recombinant human LIGHT protein, C-His (HEK293) [orb1516394]
> 95% as determined by Tris-Bis PAGE
Due to glycosylation, the protein migrates to 25-30 kDa based on Tris-Bis PAGE result. kDa
50 μg 
Mouse LIGHT Protein, hFc Tag [orb2668323]
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.5 kDa after removal of the signal peptide.
100 μg, 50 μg, 10 μgCynomolgus LIGHT Protein, hFc Tag [orb2668329]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.5 kDa after removal of the signal peptide. The apparent molecular mass of hFc-cLIGHT is approximately 35-55 kDa due to glycosylation.
100 μg, 50 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks