Human TR13C protein (Active)

SKU: orb359195

Description

Recombinant human TR13C active protein

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Cancer

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  Read more...

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to block BAFF induced mouse splenocyte survival is 1.0-5.0 µg/ml in the presence of 1.0 μg/ml of rHuBAFF.
• Tag: Tag-Free
• Expression Region: 1-76aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• MW: 7.8 kDa
• Purity: > 95% as determined by SDS-PAGE.
• Protein Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered 20 mM PB, pH 8.0, 500 mM NaCl
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

B-cell-activating factor receptor, BAFF-R, BLyS receptor 3, CD antigen CD268,

Quick Database Links

UniProt

Q96RJ3