Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human VEGFA protein

SKU: orb419318

Description

Recombinant Human Vascular endothelial growth factor A active

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Cancer,Epigenetics,Developmental Biology,Cancer

Images & Validation

Application Notes
Tag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length

Key Properties

SourceYeast
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml.
TagTag-Free
Expression Region27-191aa
Protein LengthPartial of Isoform 4
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
MW19.3 kDa
Purity> 97% as determined by SDS-PAGE and HPLC.
Protein SequenceM+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

VEGF-A, VPF

Similar Products

  • Human VEGFA Protein, His Tag [orb757432]

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 14.8 kDa after removal of the signal peptide.

    Mammalian

    50 μg, 10 μg, 100 μg
  • Human Vascular Endothelial Growth Factor A (VEGFA) EasyStep ELISA Kit [orb1950027]

    Human

    78.2-5000 pg/mL

    31 pg/mL

    48 T, 96 T
  • Human VEGF 165 protein [orb178366]

    SDS-PAGE

    Unconjugated

    > 85% as determined by SDS-PAGE

    0.5 mg, 1 mg, 0.1 mg
  • Recombinant human VEGF-165 protein, His (HEK293) [orb1516684]

    > 95% as determined by SDS-PAGE

    24 kDa

    500 μg, 100 μg, 50 μg
  • Human VEGFA Protein, hFc Tag [orb1290979]

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 40.1 kDa after removal of the signal peptide. The apparent molecular mass of VEGFA-hFc is approximately 35-55 kDa due to glycosylation.

    Mammalian

    10 μg, 50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

10 μg
$ 400.00
100 μg
$ 1,460.00
500 μg
$ 3,170.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry