You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Cancer,Epigenetics,Developmental Biology,Cancer
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 27-191aa |
| Protein Length | Partial of Isoform 4 |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 19.3 kDa |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−VEGF-A, VPF
Similar Products
−- Item 1 of 4
Human VEGFA Protein, His Tag [orb757432]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 14.8 kDa after removal of the signal peptide.
Mammalian
50 μg, 10 μg, 100 μg 
Human Vascular Endothelial Growth Factor A (VEGFA) EasyStep ELISA Kit [orb1950027]
Human
78.2-5000 pg/mL
31 pg/mL
48 T, 96 T- Item 1 of 1
Human VEGF 165 protein [orb178366]
SDS-PAGE
Unconjugated
> 85% as determined by SDS-PAGE
0.5 mg, 1 mg, 0.1 mg - Item 1 of 2
Recombinant human VEGF-165 protein, His (HEK293) [orb1516684]
> 95% as determined by SDS-PAGE
24 kDa
500 μg, 100 μg, 50 μg - Item 1 of 1
Human VEGFA Protein, hFc Tag [orb1290979]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.1 kDa after removal of the signal peptide. The apparent molecular mass of VEGFA-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks