Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Igf2bp1 Rabbit Polyclonal Antibody

SKU: orb330970

Description

Rabbit polyclonal antibody to Igf2bp1

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Various,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsWB
ReactivityMouse, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetIgf2bp1
Protein SequenceSynthetic peptide located within the following region: PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL
Molecular Weight63kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AL024068 antibody, anti AW549074 antibody, anti CRD-BP antibody, anti Crdbp antibody, anti D030026A21Rik antibody, anti D11Moh40e antibody, anti D11Moh45 antibody, anti IMP-1 antibody, anti Neilsen antibody, anti Zbp1 antibody

Similar Products

  • IGF2BP1 Rabbit Polyclonal Antibody [orb330971]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • IGF2BP1 Rabbit Polyclonal Antibody [orb1518]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • IGF2BP1 Rabbit Polyclonal Antibody [orb330140]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • IGF2BP1 Antibody (C-term) [orb28369]

    FC,  IHC-P,  WB

    Other, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
  • Anti-IGF2BP1 Antibody [orb378121]

    IF,  IH,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Igf2bp1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Igf2bp1 Rabbit Polyclonal Antibody

WB Suggested Anti-Igf2bp1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Thymus.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_034081

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Igf2bp1 Rabbit Polyclonal Antibody (orb330970)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry