IL13RA2 monoclonal antibody (M01), clone 2E10

SKU: orb2292723

Description

Mouse monoclonal antibody raised against a partial recombinant IL13RA2.

Images & Validation

• Tested Applications: ELISA, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 2E10
• Immunogen: IL13RA2 (NP_000631, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged IL13RA2 is approximately 0.1 ng/ml as a capture antibody.

IL13RA2 monoclonal antibody (M01), clone 2E10. Western Blot analysis of IL13RA2 expression in HeLa.

Western Blot analysis of IL13RA2 expression in transfected 293T cell line by IL13RA2 monoclonal antibody (M01), clone 2E10. Lane 1: IL13RA2 transfected lysate (44.176 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of IL13RA2 over-expressed 293 cell line, cotransfected with IL13RA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with IL13RA2 monoclonal antibody (M01), clone 2E10 (Cat # orb2292723). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_000631