You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Signaling Pathways,Signaling Pathways/NF-kB,Epigenetics,Neuroscience,Product Categories/Antibodies,Immunology,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins,Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling,Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones,Root Catalog/Research Areas/Cell Biology,Root Catalog/Research Areas/Immunology,Root Catalog/Research Areas/Signal Transduction,Root Catalog/Research Areas/Apoptosis,Root Catalog/Research Areas/Disease Related,Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Goat, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human IL1A |
| Target | IL1A |
| Protein Sequence | Synthetic peptide located within the following region: VPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVS |
| Molecular Weight | 29kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti Hematopoietin 1 antibody, anti Hematopoietin-1 antibody, anti IL 1 alpha antibody, anti IL 1 antibody, anti IL 1A antibody, anti IL-1 alpha antibody, anti Il-1a antibody, anti IL1 ALPHA antibody, anti IL1 antibody, anti IL1A antibody, anti IL1A_HUMAN antibody, anti IL1F1 antibody, anti ilia antibody, anti Interleukin 1 alpha antibody, anti Interleukin 1 alpha precursor antibody, anti Interleukin-1 alpha antibody, anti Interleukin1 alpha antibody, anti Preinterleukin 1 alpha antibody, anti Pro interleukin 1 alpha antibody
Similar Products
−IL-1 Alpha Rabbit Polyclonal Antibody [orb157678]
FC, WB
Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlAnti-IL-1 alpha Antibody [orb378128]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].


















