You have no items in your shopping cart.
IL4R (Human) Recombinant Protein (Q01)
SKU: orb2288381
Description
Images & Validation
−Item 1 of 1
| Tested Applications | AP, Array, ELISA, WB |
|---|---|
| Application Notes |
Key Properties
−| Tag | GST |
|---|---|
| Protein Sequence | MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV |
Storage & Handling
−| Storage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
|---|---|
| Buffer/Preservatives | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
IL4R (Human) Recombinant Protein (Q01) (orb2288381)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days