INPPL1 monoclonal antibody (M01), clone 3E6

SKU: orb2292712

This product can be custom made

Description

Mouse monoclonal antibody raised against a partial recombinant INPPL1.

Images & Validation

−

Item 1 of 3

Tested Applications	ELISA, WB
Reactivity	Human

Key Properties

−

Host	Mouse
Clonality	Monoclonal
Isotype	IgG1 Kappa
Clone No.	3E6
Immunogen	INPPL1 (NP_001558, 1159 a.a. ~ 1258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein Sequence	PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	In 1x PBS, pH 7.4
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

INPPL1 monoclonal antibody (M01), clone 3E6

Detection limit for recombinant GST tagged INPPL1 is approximately 0.1 ng/ml as a capture antibody.

INPPL1 monoclonal antibody (M01), clone 3E6 Western Blot analysis of INPPL1 expression in HeLa.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_001558

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001558

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

ELISA

Enzyme-linked Immunosorbent Assay (EIA)

View Protocol

Find More Protocols