Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

IRF1 Rabbit Polyclonal Antibody

SKU: orb573758

Description

Rabbit polyclonal antibody to IRF1

Research Area

Product Categories/Antibodies/Primary Antibodies,Cancer,Epigenetics,Product Categories/Antibodies,Immunology,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins,Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling,Root Catalog/Research Areas/Apoptosis,Root Catalog/Research Areas/Phosphorylation,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Research Areas/Cell Differentiation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IRF1
TargetIRF1
Protein SequenceSynthetic peptide located within the following region: RMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPD
Molecular Weight36kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MAR, IRF-1

Similar Products

  • IRF1 Rabbit Polyclonal Antibody [orb576535]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Anti-TRIM63 Antibody [orb668508]

    IF,  IH,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • IRF1 Rabbit Polyclonal Antibody [orb10932]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • IRF1 Rabbit Polyclonal Antibody [orb526611]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • Irf1 Rabbit Polyclonal Antibody [orb576140]

    WB

    Bovine, Canine, Guinea pig, Human, Rabbit, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

IRF1 Rabbit Polyclonal Antibody

IRF1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb573758 with 1:200 dilution. Western blot was performed using orb573758 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: IRF1 IP with orb573758 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

IRF1 Rabbit Polyclonal Antibody

Rabbit Anti-IRF1 Antibody, Catalog Number: orb573758, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

IRF1 Rabbit Polyclonal Antibody

Rabbit Anti-IRF1 Antibody, Catalog Number: orb573758, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

IRF1 Rabbit Polyclonal Antibody

WB Suggested Anti-IRF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002189

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

IRF1 Rabbit Polyclonal Antibody (orb573758)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry