KCNQ1 Rabbit Polyclonal Antibody

SKU: orb329835

Description

Rabbit polyclonal antibody to KCNQ1

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Signal Proteins,Root Catalog/Research Areas/E3 & Ubiquitin,Root Catalog/Research Areas/Disease Related,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

• Tested Applications: WB
• Reactivity: Hamster, Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ1
• Target: KCNQ1
• Protein Sequence: Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS
• Molecular Weight: 60kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti LQT antibody, anti RWS antibody, anti WRS antibody, anti LQT1 antibody, anti SQT2 antibody, anti ATFB1 antibody, anti ATFB3 antibody, anti JLNS1 antibody, anti KCNA8 antibody, anti KCNA9 antibody, anti Kv1.9 antibody, anti Kv7.1 antibody, anti KVLQT1 antibody

Quick Database Links

Gene Symbol

KCNQ1

UniProt

P51787

RefSeq (Protein):NP_861463