You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IF, IHC-P, IP, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG1 kappa |
| Clone No. | 1G2 |
| Immunogen | KIF2C (AAH14924, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western Blot detection against Immunogen (36.63 KDa).

Detection limit for recombinant GST tagged KIF2C is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to KIF2C on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]

Immunoprecipitation of KIF2C transfected lysate using anti-KIF2C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KIF2C MaxPab rabbit polyclonal antibody.

KIF2C monoclonal antibody (M01), clone 1G2 Western Blot analysis of KIF2C expression in Hela S3 NE.

Western Blot analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody (M01), clone 1G2. Lane 1: KIF2C transfected lysate(81.3 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of KIF2C over-expressed 293 cell line, cotransfected with KIF2C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KIF2C monoclonal antibody (M01), clone 1G2 (Cat # orb2291463). GAPDH (36.1 kDa) used as specificity and loading control.
Documents Download
Request a Document
Protocol Information
KIF2C monoclonal antibody (M01), clone 1G2 (orb2291463)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review