You have no items in your shopping cart.
LDHA MaxPab rabbit polyclonal antibody (D01)
SKU: orb2292663
Description
Images & Validation
−Item 1 of 3
| Tested Applications | IP, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | LDHA (NP_005557.1, 1 a.a. ~ 332 a.a) full-length human protein. |
| Protein Sequence | MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | No additive |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Immunoprecipitation of LDHA transfected lysate using anti-LDHA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with LDHA MaxPab mouse polyclonal antibody (B01).
LDHA MaxPab rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney.
Western Blot analysis of LDHA expression in transfected 293T cell line by LDHA MaxPab polyclonal antibody. Lane 1: LDHA transfected lysate (36.70 KDa). Lane 2: Non-transfected lysate.
Quick Database Links
RefSeq (Protein):NP_005557.1
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_005557.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IP
Immunoprecipitation
LDHA MaxPab rabbit polyclonal antibody (D01) (orb2292663)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days