LGALS3 purified MaxPab rabbit polyclonal antibody (D01P)

SKU: orb2292655

Description

Rabbit polyclonal antibody raised against a full-length human LGALS3 protein.

Images & Validation

−

Item 1 of 6

Tested Applications	WB
Reactivity	Human, Mouse

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	LGALS3 (AAH53667.1, 1 a.a. ~ 250 a.a) full-length human protein.
Protein Sequence	MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	In 1x PBS, pH 7.4
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

LGALS3 purified MaxPab rabbit polyclonal antibody (D01P)

LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in Hela S3 NE.

LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in human colon.

LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in human stomach.

LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in mouse brain.

LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in Raw 264.7.

Western Blot analysis of LGALS3 expression in transfected 293T cell line by LGALS3 MaxPab polyclonal antibody. Lane 1: LGALS3 transfected lysate (26.20 KDa). Lane 2: Non-transfected lysate.

Quick Database Links

RefSeq:AAH53667.1

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

RefSeq	AAH53667.1

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols