You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Signaling Pathways,Signaling Pathways/GPCR,Epigenetics,Neuroscience,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Research Areas/Cardiovascular,Root Catalog/Research Areas/Immunology,Root Catalog/Research Areas/GPCR,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−
Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LTB4R |
| Target | LTB4R |
| Protein Sequence | Synthetic peptide located within the following region: AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVG |
| Molecular Weight | 37kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti-LTB4 R 1 antibody, anti-LTB4-R 1 antibody, anti-LTB4-R1 antibody, anti-LTB4R 1 antibody, anti-Ltb4r antibody, anti-LTB4R1 antibody, anti-LTBR1 antibody, anti-Chemoattractant receptor-like 1 antibody, anti-Chemokine receptor like 1 antibody, anti-Leukotriene B4 G Protein coupled receptor antibody, anti-Leukotriene B4 receptor 1 antibody, anti-Leukotriene B4 receptor antibody, anti-BLT antibody, anti-BLT1 antibody, anti-BLTR antibody, anti-LTB4 receptor 1 antibody
Similar Products
−- Item 1 of 3
LTB4-R1 Rabbit Polyclonal Antibody [orb6335]
ELISA
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 2
LTB4R2 Rabbit Polyclonal Antibody [orb331272]
WB
Bovine, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
LTB4-R1/LTB4R Rabbit Polyclonal Antibody [orb559494]
WB
Equine, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μl - Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Available Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 1 - 2 weeks