Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)

SKU: orb1979242

Description

Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin. Major curlin subunit Protein, E. coli O157:H7, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 14.6 kDa and the accession number is Q93U24.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: E. coli
• Biological Activity: Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin. Major curlin subunit Protein, E. coli O157:H7, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 14.6 kDa and the accession number is Q93U24.
• Tag: C-6xHis
• Expression Region: 21-152 aa
• MW: 14.6 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: GVVPQYGGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQADARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSHMTVKQFGGGNGAAVDQTASNSTVNVTQVGFGNNATAHQY

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

Q93U24