MazF Protein, S. epidermidis, Recombinant (His)

SKU: orb1976339

Description

Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE. MazF Protein, S. epidermidis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.0 kDa and the accession number is Q9F7V5.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: E. coli
• Biological Origin: Staphylococcus epidermidis
• Biological Activity: Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE. MazF Protein, S. epidermidis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.0 kDa and the accession number is Q9F7V5.
• Tag: N-6xHis
• Expression Region: 1-120 aa
• MW: 19.0 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

Q9F7V5