MFN2 monoclonal antibody (M01), clone 6A8

SKU: orb2291658

Description

Mouse monoclonal antibody raised against a partial recombinant MFN2.

Images & Validation

• Tested Applications: ELISA, IHC-P, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 6A8
• Immunogen: MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged MFN2 is 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

MFN2 monoclonal antibody (M01), clone 6A8. Western Blot analysis of MFN2 expression in HeLa.

MFN2 monoclonal antibody (M01), clone 6A8. Western Blot analysis of MFN2 expression in NIH/3T3.

MFN2 monoclonal antibody (M01), clone 6A8. Western Blot analysis of MFN2 expression in PC-12.

Quick Database Links

RefSeq (Protein):NP_055689