MFN2 monoclonal antibody (M03J), clone 4H8

SKU: orb2291657

Description

Mouse monoclonal antibody raised against a full length recombinant MFN2.This product is belong to Cell Culture Grade Antibody (CX Grade).

Images & Validation

• Tested Applications: ELISA, IHC-P, WB
• Reactivity: Human, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 4H8
• Immunogen: MFN2 (NP_055689, 661 a.a. ~ 757 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged MFN2 is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5 ug/ml]

Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03A), clone 4H8. Lane 1: MFN2 transfected lysate (86.4 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody (M03), clone 4H8. GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.41 KDa).

Quick Database Links

RefSeq (Protein):NP_055689