Miraculin Protein, Synsepalum dulcificum, Recombinant (E. coli, His)

SKU: orb1976305

Description

Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. Miraculin Protein, Synsepalum dulcificum, Recombinant (E. coli, His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 24.9 kDa and the accession number is P13087.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: E. coli
• Biological Origin: Synsepalum dulcificum
• Biological Activity: Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. Miraculin Protein, Synsepalum dulcificum, Recombinant (E. coli, His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 24.9 kDa and the accession number is P13087.
• Tag: N-10xHis
• Expression Region: 30-220 aa
• MW: 24.9 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P13087