MMP1 MaxPab rabbit polyclonal antibody (D01)

SKU: orb2292588

This product can be custom made

Description

Rabbit polyclonal antibody raised against a full-length human MMP1 protein.

Images & Validation

−

Item 1 of 4

Tested Applications	IHC-P, IP, WB
Reactivity	Human

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	MMP1 (NP_002412.1, 1 a.a. ~ 469 a.a) full-length human protein.
Protein Sequence	MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	No additive
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

MMP1 MaxPab rabbit polyclonal antibody (D01)

Immunoperoxidase of purified MaxPab rabbit antibody to MMP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Immunoprecipitation of MMP1 transfected lysate using anti-MMP1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MMP1 purified MaxPab mouse polyclonal antibody (B01P) (orb2292589).

MMP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of MMP1 expression in human pancreas.

Western Blot analysis of MMP1 expression in transfected 293T cell line by MMP1 MaxPab polyclonal antibody. Lane 1: MMP1 transfected lysate (54.00 KDa). Lane 2: Non-transfected lysate.

Quick Database Links

RefSeq (Protein):NP_002412.1

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_002412.1

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC-P

Immunohistochemistry Paraffin

View Protocol

Immunoprecipitation

View Protocol

Find More Protocols