You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Membrane Protein,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MOGAT1 |
| Target | MOGAT1 |
| Protein Sequence | Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK |
| Molecular Weight | 39kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti-2-acylglycerol O-acyltransferase 1 antibody, anti-Acyl-CoA:monoacylglycerol acyltransferase 1 antibody, anti-MGAT1 antibody, anti-Diacylglycerol O-acyltransferase candidate 2 antibody, anti-hDC2 antibody, anti-Diacylglycerol acyltransferase 2-like protein 1 antibody, anti-Monoacylglycerol O-acyltransferase 1 antibody, anti-DC2 antibody, anti-DGAT2L1 antibody
Similar Products
−MOGT1 Rabbit Polyclonal Antibody [orb185186]
IF, IHC-Fr, IHC-P
Human, Porcine, Rabbit, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μlMOGT1 Rabbit Polyclonal Antibody (PerCP-Cy5.5) [orb2487240]
IF
Human, Porcine, Rabbit, Rat
Mouse
Rabbit
Polyclonal
PerCP/Cy5.5
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].










