You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Others
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Macaca mulatta (Rhesus macaque) |
| Tag | N-terminal GST-tagged |
| Expression Region | 24-155aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 42.1 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Il17a Ctla8 Il17
Similar Products
−- Item 1 of 1
Recombinant Cyn. monkey IL17A protein, C-His-Avi (HEK293) [orb1516413]
> 95% as determined by Tris-Bis PAGE
Due to glycosylation, the protein migrates to 26-32 kDa based on Tris-Bis PAGE result. kDa
50 μg, 100 μg Rhesus Monkey IL17A & IL17F Protein, His Tag [orb2698042]
> (65.3+32.9)%, determined by SDS-PAGE
This protein contains the rhesus monkey IL17A (XP_0011063911) (Met 1 - Ala 155) and the mature form of rhesus monkey IL17F (NP_0012482161) (Arg 31 - Gln 163) linked by a polypeptide linker was expressed with a polyhistidine tag at the C-terminus and expressed from HEK293 Cells.
100 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks