You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mouse |
| Target | BAFF |
| Protein Length | 183 |
| MW | 20.6 kDa |
| Purity | 98% |
| Protein Sequence | AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL (183) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human BAFF-R Protein, mFc Tag [orb689403]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 33.6 kDa after removal of the signal peptide.The apparent molecular mass of BAFF-R-mFc is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μgMouse BAFF Protein, hFc Tag [orb1290846]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.8 kDa after removal of the signal peptide. The apparent molecular mass of hFc-mBAFF is approximately 40-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].




