You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Metabolism
Images & Validation
−
Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 23-246aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 31.1 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
Storage & Handling
−| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−C1qtnf3; Cors26; Ctrp3; Complement C1q tumor necrosis factor-related protein 3; Collagenous repeat-containing sequence 26 kDa protein; CORS26; Secretory protein CORS26
Similar Products
−- Item 1 of 1
Mouse C1q Tumor Necrosis Factor Related Protein 3 (C1QTNF3) ELISA Kit [orb781465]
Mouse
0.32-20 ng/mL
0.137 ng/mL
48 T, 96 T 
Mouse C1qtnf3 protein [orb605285]
Greater than 85% as determined by SDS-PAGE.
26.6 kDa
Mammalian cell
1 mg, 20 μg, 100 μgMouse C1qtnf3 protein [orb595134]
Greater than 85% as determined by SDS-PAGE.
26.6 kDa
Baculovirus
1 mg, 20 μg, 100 μg- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks