You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Immunology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 23-108aa |
| Protein Length | Extracellular Domain |
| Endotoxins | Not test. |
| MW | 11.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−FLJ18683 Proteins, T3E Proteins, TCRE Proteins, CD3E Proteins, CD3-epsilon Proteins, CD3 epsilon Proteins, CD3E Proteins, CD3E antigen epsilon polypeptide (TiT3 complex) Proteins, CD3E antigen epsilon polypeptide Proteins, CD3E antigen Proteins, epsilon subunit Proteins, CD3E molecule epsilon Proteins, CD3E molecule Proteins, epsilon (CD3 TCR complex) Proteins, CD3E molecule Proteins, epsilon (CD3-TCR complex) Proteins, CD3E_HUMAN Proteins, IMD18 Proteins, T cell antigen receptor complex epsilon subunit of T3 Proteins, T cell surface antigen T3/Leu 4 epsilon chain Proteins, T cell surface glycoprotein CD3 epsilon chain Proteins, T-cell surface antigen T3/Leu-4 epsilon chain Proteins, T-cell surface glycoprotein CD3 epsilon chain Proteins, T3E Proteins, TCRE Proteins
Similar Products
−
Mouse Cd3e Protein [orb1477998]
Greater than 90% as determined by SDS-PAGE.
17.3 kDa
E.coli
1 mg, 20 μg, 100 μg- Item 1 of 1
- Item 1 of 1
Mouse CD3E & CD3G Protein, Fc Tag [orb2698044]
> (9.1+76.7+7.8)%, determined by SDS-PAGE
This protein contains (Met1-Asp108) of mouse CD3E (NP_0316741) was fused with the Fc region of human IgG1 at the C-terminus, constructed the plasmid 1; This protein contains (Met1-Ser116) of mouse CD3G (NP_0339801) was fused with the Fc region of human IgG1 at the C-terminus, constructed the plasmid 2 . The two plasmids were co-expressed and the mouse CD3E/CD3G heterodimer was purified and expressed from HEK293 Cells.
100 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Mouse CD3E protein (orb383173)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks