You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mouse |
| Target | CXCL12 |
| Protein Length | 99 |
| MW | 11.6 kDa |
| Purity | 98% |
| Protein Sequence | GKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN (99) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-8
Similar Products
−- Item 1 of 1
Mouse SDF1 protein (Active) [orb359099]
> 97% as determined by SDS-PAGE and HPLC.
8.0 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Mouse SDF1 protein (Active) [orb359100]
> 97% as determined by SDS-PAGE and HPLC.
8.5 kDa
E.Coli
10 μg, 100 μg, 500 μg 
Mouse SDF-1 α/SDF1A ELISA Kit [orb409141]
Mouse
0.156 ng/mL-10 ng/mL
0.039 ng/mL
24 T, 48 T, 96 T, 10 x 96 T, 5 x 96 TMouse SDF1 ELISA Kit [orb409142]
Mouse
31.25 pg/mL-2000 pg/mL
7.81 pg/mL
24 T, 10 x 96 T, 5 x 96 T, 48 T, 96 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days