You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mouse |
| Target | IFN gamma |
| Protein Length | 133 |
| MW | 15.5 kDa |
| Purity | 98% |
| Protein Sequence | HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC (133) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Mouse IFN gamma protein [orb604180]
Greater than 90% as determined by SDS-PAGE.
19.1 kDa
E.coli
20 μg, 100 μg, 1 mgMouse Il18 protein [orb604186]
Greater than 85% as determined by SDS-PAGE.
26.1 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant mouse IL18 protein, N-His [orb1808082]
> 90% as determined by SDS-PAGE
18.9 kDa
500 μg, 100 μgRecombinant mouse IFN Gamma protein, C-His [orb1516854]
> 95% as determined by SDS-PAGE
14 kDa
500 μg, 100 μgMouse IFN gamma protein [orb707213]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

