You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mouse |
| Target | IL-17A |
| Protein Length | 133 |
| MW | 15.0 kDa |
| Purity | 98% |
| Protein Sequence | AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA (133) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Mouse Interleukin 17A (IL-17A) High Sensitivity ELISA Kit [orb1945908]
Mouse
0.78-50pg/mL
0.41 pg/mL
96 T, 48 T - Item 1 of 1
Mouse Interleukin 17A (IL-17A) Microsample Fast ELISA Kit [orb1806764]
Mouse
3.13-200pg/mL
1.88 pg/mL
48 T, 96 T - Item 1 of 1
Mouse Il17a protein [orb594832]
Greater than 95% as determined by SDS-PAGE.
16.2 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days