You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 19-178aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 18.9 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-10;Il10;IL-10;Cytokine synthesis inhibitory factor;CSIF;
Similar Products
−- Item 1 of 1
Mouse IL10 protein (Active) [orb359015]
> 97% as determined by SDS-PAGE and HPLC.
18.7 kDa
E.Coli
500 μg, 100 μg, 10 μg - Item 1 of 1
Mouse IL10 protein [orb80068]
FA, HPLC, SDS-PAGE
Unconjugated
> 98.0% as determined by RP-HPLC and analysis by SDS-PAGE
10 μg, 100 μg, 500 μg 
Mouse IL10 protein [orb391909]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Mouse Interleukin-10 protein(Il10) (Active) [orb1650677]
10 μg, 100 μg, 1 mg, 250 μg, 500 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks