You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Others
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 22-89aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 12 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−12-O-tetradecanoylphorbol 13-acetate repressed protein 1 , TPAR1C-X-C motif chemokine 12, Pre-B cell growth-stimulating factor , PBSFThymic lymphoma cell-stimulating factor , TLSF
Similar Products
−- Item 1 of 1
Mouse SDF1 protein (Active) [orb359099]
> 97% as determined by SDS-PAGE and HPLC.
8.0 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Mouse SDF1 protein (Active) [orb359100]
> 97% as determined by SDS-PAGE and HPLC.
8.5 kDa
E.Coli
10 μg, 100 μg, 500 μg 
Mouse SDF-1 α/SDF1A ELISA Kit [orb409141]
Mouse
0.156 ng/mL-10 ng/mL
0.039 ng/mL
24 T, 48 T, 96 T, 10 x 96 T, 5 x 96 TMouse SDF1 ELISA Kit [orb409142]
Mouse
31.25 pg/mL-2000 pg/mL
7.81 pg/mL
24 T, 10 x 96 T, 5 x 96 T, 48 T, 96 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks