You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 1-117aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 28.7 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name, TIR8
Similar Products
−
Mouse Sigirr protein [orb383127]
Greater than 90% as determined by SDS-PAGE.
14.7 kDa
Yeast
1 mg, 20 μg, 100 μgMouse SIGIRR Protein, Fc Tag [orb2698911]
> 95%, determined by SDS-PAGE
This protein contains the mouse IL1RAPL1 (P59823) extracellular domain (Met 1-Thr 357) was fused with the Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells.
50 μg, 100 μgMouse SIGIRR Protein, Fc & His Tag [orb2699408]
> 95%, determined by SDS-PAGE
This protein contains the mouse SIGIRR (NP_0755462) (Met 1-His 117) was fused with the C-terminal polyhistidine-tagged Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells.
100 μg, 200 μgSIGIRR Protein, Mouse, Recombinant (His & hFc) [orb1958609]
98.00%
40.7 kDa (predicted); 60-65 kDa (reducing condition, due to glycosylation)
100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks