Mouse Tfap2a protein

SKU: orb604404

Description

Recombinant Mouse Transcription factor AP-2-alpha(Tfap2a)

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Epigenetics and Nuclear Signaling

Images & Validation

• Application Notes:
  Full Length

Key Properties

• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Expression Region: 1-437aa
• Protein Length: Full Length
• Endotoxins: Not test.
• MW: 55.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALGSGLGDLPIHSLPHAIEDVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNSAKSSDKEEKHRK

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AP-2 transcription factor (Activating enhancer-binding protein 2-alpha) (Activator protein 2) (AP-2) (Ap2tf) (Tcfap2a)

Quick Database Links

UniProt

P34056