Mouse TNFα

SKU: orb1729591

Description

TNFα is a cytokine that Tumor necrosis factor alpha (TNF-α), is a member of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, apoptosis, and immune system development. TNF-α is produced by a wide variety of cell types. Mature extracellular domain of murineTNF-α forms a soluble trimer. TNF-α trimers bind the ubiquitous TNF RI and the hematopoietic cell-restricted TNF RII, both of which are also expressed as homotrimers. TNF-α is a key cytokine in the development of several inflammatory disorders

Images & Validation

• Tested Applications: SDS-PAGE
• Application Notes:
  For research use only

Key Properties

• Source: Mouse
• Species/Host: E. coli
• Expression System: Intercellular
• Biological Origin: Recombinant protein expressed as His tage protein in E.coli
• Reactivity: Human, Mouse
• Tag: Histidine
• Endotoxins: Not tested
• Conjugation: Unconjugated
• MW: ~18 kDa
• Purity: ≥98%
• Protein Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Storage & Handling

• Storage: After reconstitution, store at -20°C; Avoid repeated freeze thaw
• Form/Appearance: Lyophilized
• Buffer/Preservatives: No preservative
• Concentration: 1mg/mL
• Expiration Date: 6 months from date of receipt.
• Hazard Information: For Research use only
• Disclaimer: For research use only

Alternative Names

TNFSF1A, TNFSF2