You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 2-8 pg/ml. |
| Tag | Tag-Free |
| Expression Region | 89-235aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 16.4 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Anti-Tropomyosin 2/TPM2 Antibody [orb1291659]
FC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
10 μg, 100 μgMouse Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA Kit [orb778929]
Mouse
78.13-5000 pg/mL
29 pg/mL
48 T, 96 TMouse Cluster of Differentiation 40 Ligand (CD40L) ELISA Kit [orb776172]
Mouse
15.63-1000 pg/mL
6.8 pg/mL
96 T, 48 TMouse Metalloreductase STEAP4 (STEAP4) ELISA Kit [orb1736757]
Mouse
0.16-10 ng/mL
0.067 ng/mL
96 T, 48 TMouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit [orb781809]
Mouse
78.13-5000 pg/mL
29 pg/mL
48 T, 96 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Mouse Tnf protein (orb594857)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review











