Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Mouse VEGF-A Recombinant Protein

SKU: orb1820720

Description

The Mouse VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Mouse VEGF-A Specifications: (Molecular Weight: 19.3 kDa) (Amino Acid Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)) (Gene ID: 22339).

Images & Validation

Key Properties

SourceYeast
Biological OriginMouse
TargetVEGF-A
Protein Length164
MW19.3 kDa
Purity98%
Protein SequenceAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Mouse VEGFA protein [orb392697]

    ELISA,  MS,  SDS-PAGE,  WB

    Greater than 95% as determined by reducing SDS-PAGE.

    P. pastoris

    50 μg, 500 μg, 10 μg
  • Mouse VEGF-A protein [orb1216258]

    98%

    19.3 kDa

    Yeast

    100 μg
  • Mouse VEGF164 protein [orb555837]

    500 μg, 1 mg, 10 μg, 50 μg
  • Mouse mVEGF (121a.a.) Protein [orb752980]

    Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

    Saccharomyces cerevisiae

    100 μg, 1 mg, 250 μg
  • Mouse mVEGF Protein [orb752979]

    Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

    Saccharomyces cerevisiae

    1 mg, 100 μg, 250 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NCBI Gene Details

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

500 μg
$ 4,260.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry