MTM1 monoclonal antibody (M01), clone 1C10

SKU: orb2292568

Description

Mouse monoclonal antibody raised against a partial recombinant MTM1.

Images & Validation

• Tested Applications: ELISA, IHC-P, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 1C10
• Immunogen: MTM1 (AAH30779, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNYRLYLRSLETDSSLILDVPLGVISRIEKMGGAT
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged MTM1 is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to MTM1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]

Western Blot analysis of MTM1 expression in transfected 293T cell line by MTM1 monoclonal antibody (M01), clone 1C10. Lane 1: MTM1 transfected lysate (69.9 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of MTM1 over-expressed 293 cell line, cotransfected with MTM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MTM1 monoclonal antibody (M01), clone 1C10 (Cat # orb2292568). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.63 KDa).

Quick Database Links

RefSeq:AAH30779