NEDD4L Rabbit Polyclonal Antibody

SKU: orb330290

Description

Rabbit polyclonal antibody to NEDD4L

Research Area

Product Categories/Antibodies/Primary Antibodies,Infectious Diseases,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Research Areas/E3 & Ubiquitin,Root Catalog/Research Areas/Membrane & Traffic,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

−

Item 1 of 4

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human NEDD4L
Target	NEDD4L
Protein Sequence	Synthetic peptide located within the following region: TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP
Molecular Weight	110 kDa
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti FLJ33870 antibody, anti KIAA0439 antibody, anti RSP5 antibody, anti hNedd4-2 antibody, anti NEDD4-2 antibody, anti NEDD4.2 antibody, anti hNEDD4-2 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/mL.

Human cystic fibrosis epithelial.

WB Suggested Anti-NEDD4L Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate.

Quick Database Links

Gene Symbol

NEDD4L

UniProt

Q96PU5

RefSeq (Protein):NP_056092

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_056092

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols