NEK9 monoclonal antibody (M01), clone 1F6

SKU: orb2290718

Description

Mouse monoclonal antibody raised against a partial recombinant NEK9.

Images & Validation

• Tested Applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 1F6
• Immunogen: NEK9 (AAH09336, 226 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: AGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged NEK9 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NEK9 on HeLa cell. [antibody concentration 10 ug/ml]

NEK9 monoclonal antibody (M01), clone 1F6 Western Blot analysis of NEK9 expression in HeLa.

NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in NIH/3T3.

NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in PC-12.

NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in Raw 264.7.

Western Blot analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6. Lane 1: NEK9 transfected lysate(107.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq:AAH09336