NME2 monoclonal antibody (M06), clone 1D3

SKU: orb2292511

Description

Mouse monoclonal antibody raised against a partial recombinant NME2.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3 Kappa
• Clone No.: 1D3
• Immunogen: NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged NME2 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to NME2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]

NME2 monoclonal antibody (M06), clone 1D3 Western Blot analysis of NME2 expression in HeLa.

NME2 monoclonal antibody (M06), clone 1D3. Western Blot analysis of NME2 expression in NIH/3T3.

NME2 monoclonal antibody (M06), clone 1D3. Western Blot analysis of NME2 expression in PC-12.

NME2 monoclonal antibody (M06), clone 1D3. Western Blot analysis of NME2 expression in Raw 264.7.

Western Blot detection against Immunogen (36.96 KDa).

Quick Database Links

RefSeq (Protein):NP_002503