Oncostatin M/OSM Protein, Rat, Recombinant (His)

SKU: orb1976575

Description

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. Oncostatin M/OSM Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is Q65Z15.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: HEK293 Cells
• Biological Origin: Rat
• Biological Activity: Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. Oncostatin M/OSM Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is Q65Z15.
• Tag: N-10xHis
• Expression Region: 26-208 aa
• MW: 24.2 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

Q65Z15